Protein Info for Pf6N2E2_559 in Pseudomonas fluorescens FW300-N2E2

Annotation: Inner membrane protein DotU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 208 to 230 (23 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 21 to 231 (211 residues), 126 bits, see alignment E=9.3e-41 PF09850: DotU" amino acids 70 to 225 (156 residues), 105.6 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 97% identity to pba:PSEBR_a3313)

Predicted SEED Role

"Inner membrane protein DotU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUB3 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Pf6N2E2_559 Inner membrane protein DotU (Pseudomonas fluorescens FW300-N2E2)
MPDGSGGAVRSLHEAPLSSAFRQAWLKWSQEWQDLPKDSDPAVLVNRVVEFSGRSAQRLW
RVAFATVGDAATEQVKSLVYAFVALVDETLLFSPWPGQLAWQQHPLESRMYASRQAGERL
PAAIKKLLDEQMPGTRDLANVYLQCLILGFQGRLRGEPGQVQHEKWRLALFTFAWQHEPD
YVDVSQRLALSAATPPMRMPVQQSLPDGFRLGLAILAMVLLLTGLGQVFWRDIRLELEPV
LQLNESAVVQEQDS