Protein Info for Pf6N2E2_558 in Pseudomonas fluorescens FW300-N2E2

Annotation: Uncharacterized protein ImpJ/VasE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR03353: type VI secretion protein, VC_A0114 family" amino acids 7 to 436 (430 residues), 288 bits, see alignment E=5.9e-90 PF05936: T6SS_VasE" amino acids 20 to 386 (367 residues), 129.1 bits, see alignment E=1e-41

Best Hits

KEGG orthology group: K11893, type VI secretion system protein ImpJ (inferred from 99% identity to pba:PSEBR_a3314)

Predicted SEED Role

"Uncharacterized protein ImpJ/VasE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZT45 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Pf6N2E2_558 Uncharacterized protein ImpJ/VasE (Pseudomonas fluorescens FW300-N2E2)
MSLLPDAVCWHEGMQLLPQHFQLQGLRAEALAAYFAGACNPWFWGVSQLEVDPSALSAGQ
VRLLQLQGTLPDGLPVNLQAGVGPPLELDIGEAIDKTDDATVTVYLAVSPLWRAGQLVPL
KGRLQSVVGEALPDLTSGAFPESITVWRPNPRLCTQLSKADSICLPLLRIRKEGGGFWRV
PYTPPTPILLPESALGRRVAGVCARAREKCMFLAGRLRQAQAAGNQDDAMEIRRQLTALW
ARLPEVEGALNTRVATPQALYGLLLGLAGSWSALDPLAGVPAFAPLDFLELQRGYEPLLD
WLETTLELVRAGYRSLAFERNEQVFSIQLPDDQPDQRLVIGLRMPNGASEQAAGEWLRGA
IIASARHIPLLSRQRMSGLPHQAMSRNEQVAYSVGDDTRLFVVAASGQWFDAQLPLHIVA
PASAQASSPWQVVLFVAQASESA