Protein Info for Pf6N2E2_5579 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ornithine carbamoyltransferase (EC 2.1.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00658: ornithine carbamoyltransferase
  • amino acids 4 to 299 (296 residues), 373.9 bits, E=2.8e-116
• PF02729: OTCace_N
  • amino acids 4 to 144 (141 residues), 155.5 bits, E=1.1e-49
• PF00185: OTCace
  • amino acids 150 to 297 (148 residues), 176.1 bits, E=5.4e-56

Best Hits

Swiss-Prot: 88% identical to OTC_PSESM: Ornithine carbamoyltransferase (argF) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 99% identity to pba:PSEBR_a4400)

MetaCyc: 52% identical to ArgF (Bacillus subtilis)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (5/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (2/6 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

See A0A160A268 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Pf6N2E2_5579 Ornithine carbamoyltransferase (EC 2.1.3.3) (Pseudomonas fluorescens FW300-N2E2)
MSARHFLSLMDFTPDELLGVIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRISF
EAGMIQLGGQAIFLSPRDTQLGRGEPISDCAIVMSGMLDAVMIRTFAHSTLTEFAAHSRV
PVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAALQFDFQLRI
ACPEGYDPNAELLAKAGERVTIVRDPKQAVAGAHLVSTDVWTSMGQEEETAKRLELFAPL
QVNRALLDLADADVLFMHCLPAHRGEEISFDLLDDPRSVAWDQAENRLHAQKALLEFLVE
PAYHHA