Protein Info for Pf6N2E2_5573 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glycerol-3-phosphate regulon repressor, DeoR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF08279: HTH_11" amino acids 6 to 45 (40 residues), 32.6 bits, see alignment 8.8e-12 PF08220: HTH_DeoR" amino acids 6 to 61 (56 residues), 74.9 bits, see alignment E=5e-25 PF00455: DeoRC" amino acids 75 to 231 (157 residues), 177.5 bits, see alignment E=3.1e-56

Best Hits

Swiss-Prot: 80% identical to GLPR_PSEAE: Glycerol-3-phosphate regulon repressor (glpR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02444, DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor (inferred from 100% identity to pba:PSEBR_a4406)

Predicted SEED Role

"Glycerol-3-phosphate regulon repressor, DeoR family" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WKB1 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Pf6N2E2_5573 Glycerol-3-phosphate regulon repressor, DeoR family (Pseudomonas fluorescens FW300-N2E2)
MNLPPRQQQILELVRERGYVSIEEMAQLFVVTPQTIRRDINQLAEVNLLRRYHGGAAYDS
SVENTAYAMRADQMRDEKQRIAEAIAAQIPDHASLFINIGTTTESIARALLNHNHLKVIT
NNLHVASILSAKDDFEVLIAGGNVRRDGGVVGQASVDFINQFKVDFALVGISGIDEDGSL
LDFDYQEVRVSQAIIANARQVLLAADSSKFGRNAMVRLGPISLIDCLVTDQQPVPALAQL
LSQHKIRLEVV