Protein Info for Pf6N2E2_5570 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00497: SBP_bac_3" amino acids 39 to 269 (231 residues), 100.1 bits, see alignment E=8.5e-33

Best Hits

Swiss-Prot: 62% identical to GLTI_SALTY: Glutamate/aspartate import solute-binding protein (gltI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10001, glutamate/aspartate transport system substrate-binding protein (inferred from 99% identity to pba:PSEBR_a4408)

MetaCyc: 58% identical to glutamate/aspartate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTY9 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Pf6N2E2_5570 Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4) (Pseudomonas fluorescens FW300-N2E2)
MRIVPHLLGAAMAAALISTPVFAAELTGTLKKIKESGVITLGHRDASIPFSYIADASGKP
VGYSHDIQMKVVEALKKDLDLPNLQIKYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQ
QVDFSVGIFEIGTKLLSKKDSKYKDFDDLKGKNVVTTAGTTSERILKAMNADKQMGMNVI
SAKDHGESFQMLESGRAVAFMMDDALLAGEAAKAKKADDWAVTGTPQSYEIYGCMMRKGD
EPFKKAVDDAIKATYASGEINKIYEKWFMQPIPPKGLNLNFPMSDELKALIAKPTDKAAD
DKKS