Protein Info for Pf6N2E2_5564 in Pseudomonas fluorescens FW300-N2E2

Annotation: Membrane protein glpM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 26 to 46 (21 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details PF06942: GlpM" amino acids 5 to 111 (107 residues), 166 bits, see alignment E=1.5e-53

Best Hits

Swiss-Prot: 81% identical to GLPM_PSEAE: Membrane protein GlpM (glpM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02442, membrane protein GlpM (inferred from 95% identity to pfo:Pfl01_4541)

Predicted SEED Role

"Membrane protein glpM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4Z1 at UniProt or InterPro

Protein Sequence (112 amino acids)

>Pf6N2E2_5564 Membrane protein glpM (Pseudomonas fluorescens FW300-N2E2)
VDLIFKAALGAAVVVILAMLAKTRNYYIAGLVPLFPTFALIAHYIVGKGRSVDDLKTTIV
FGMWSIIPYFVYLVTLYVMVDRMRLEASLAVAAVAWLMAATVLVSVWVRVHG