Protein Info for Pf6N2E2_5562 in Pseudomonas fluorescens FW300-N2E2

Annotation: Metallo-beta-lactamase superfamily protein PA0057

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00753: Lactamase_B" amino acids 41 to 227 (187 residues), 58.6 bits, see alignment E=4.3e-20

Best Hits

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a4416)

Predicted SEED Role

"Metallo-beta-lactamase superfamily protein PA0057" in subsystem PA0057 cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A415 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Pf6N2E2_5562 Metallo-beta-lactamase superfamily protein PA0057 (Pseudomonas fluorescens FW300-N2E2)
MTAFTPLKRLLLATASLAFAAHTWAADLTLDVYNPGAAAIFPVTSVLVSGEREAILVDAQ
FGKSQAVQVVEKIRASGKQLTTIYISHGDPDYYFGLETLVAAFPEAKVLASAPTVEHITQ
TMDGKLKYWGPILKTDAPAKAIVPQVLKGDSLTLEGQRLQVVGLDGPQPDRSFVWIPSIK
AVVGGVVVAENIHVWMADTQTPQSHKDWLATLANIEKLQPGTVIPGHYLGDSARSLAPVR
FTADYIRAFDEETAKAKDSAALIRAMKLRYPDLGEDSSLELSAKVAKGEMRW