Protein Info for Pf6N2E2_5551 in Pseudomonas fluorescens FW300-N2E2

Annotation: Copper resistance protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF05275: CopB" amino acids 102 to 306 (205 residues), 311 bits, see alignment E=1.8e-97

Best Hits

Swiss-Prot: 79% identical to COPB_PSEUB: Copper resistance protein B (copB) from Pseudomonas syringae pv. tomato

KEGG orthology group: K07233, copper resistance protein B (inferred from 96% identity to pba:PSEBR_a4427)

Predicted SEED Role

"Copper resistance protein B" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A408 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Pf6N2E2_5551 Copper resistance protein B (Pseudomonas fluorescens FW300-N2E2)
MTTFFQYPMALIASLTLGATTSAWAAGNDMQGMDHSQMPGMDHSQMQGMDSMQGMDSMQG
MEPMQSAPTTSRTPIPELTAADRAAVYEDHGGHAVHDSAINSFFLIDQLEWQDADDGSAL
SWDASGWIGGDIDRLWLRSEGERLNGKTDEAELQALWGHAISPWWDLVAGVRQDFKPGDA
QTWAAFGVQGMALYNFEAEATAFIGEGGQSAARLEGDYDILLTNRLILQPTAEVNFYGKN
DPARGVGSGLSDTELGVRLRYEIRREFAPYVGVTWNRTYGNTADYARAEGEDRSEARLVL
GLRMWF