Protein Info for Pf6N2E2_5545 in Pseudomonas fluorescens FW300-N2E2

Annotation: Queuosine Biosynthesis QueE Radical SAM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR04349: putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE" amino acids 5 to 215 (211 residues), 361.7 bits, see alignment E=6.1e-113 PF13353: Fer4_12" amino acids 26 to 86 (61 residues), 22.6 bits, see alignment E=1.2e-08 PF04055: Radical_SAM" amino acids 31 to 167 (137 residues), 56.3 bits, see alignment E=4.8e-19

Best Hits

Swiss-Prot: 42% identical to QUEE_KORVE: 7-carboxy-7-deazaguanine synthase (queE) from Koribacter versatilis (strain Ellin345)

KEGG orthology group: K10026, queuosine biosynthesis protein QueE (inferred from 99% identity to pba:PSEBR_a4433)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZPR1 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Pf6N2E2_5545 Queuosine Biosynthesis QueE Radical SAM (Pseudomonas fluorescens FW300-N2E2)
MQDTLRITEVFHSLQGETRTAGLPTVFVRLTGCPLRCQYCDSAYAFSGGTVRTLDDILEQ
VASYRPRYVCVTGGEPLAQPNAILLLKQLCDAGYEVSLETSGALDISAVDPRVSRVVDLK
TPGSKEAHRNRYENIELLTPNDQVKFVICSREDYDWAVSKLIQYGLDQRAGEVLLSPSHH
DLSARDLADWVVADNLPVRLQLQLHKYLWNDEPGR