Protein Info for Pf6N2E2_5541 in Pseudomonas fluorescens FW300-N2E2

Annotation: TolA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details TIGR02794: protein TolA" amino acids 15 to 353 (339 residues), 204.3 bits, see alignment E=3.3e-64 PF13103: TonB_2" amino acids 265 to 334 (70 residues), 41.5 bits, see alignment E=1.2e-14 TIGR01352: TonB family C-terminal domain" amino acids 280 to 351 (72 residues), 47.2 bits, see alignment E=2.3e-16 PF03544: TonB_C" amino acids 289 to 340 (52 residues), 28.9 bits, see alignment 1.3e-10

Best Hits

Swiss-Prot: 62% identical to TOLA_PSEAE: Tol-Pal system protein TolA (tolA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03646, colicin import membrane protein (inferred from 97% identity to pba:PSEBR_a4436)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A402 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Pf6N2E2_5541 TolA protein (Pseudomonas fluorescens FW300-N2E2)
MQQQREPSASESYFWPSVLAIGLHVLVFGMLFVSFAMTPELPPAKPIVQATLYQLKSKSQ
ATTQTNQKLAGEAKKSAARQTEVEQMEQKKVEQEAIKAAEQKKEEAAQKAEDAKKADEAK
KADEAKKADEAKKADEAKKAEAKKAEEKQLADIAKKKAEEEAKKAAEEEAKKAAAEEAKK
KIVEDAKKKAAEDAKKKAEAEEAKKKVAEDAKKKAAADAAKKKAQDAARKSAEDKKAQAL
ADLLSDTPERQQALADEQGDEVAGSYDDLIRARAAEGWARPPSARKGMTVVLQIGMLPDG
TVTSVSVAKSSGDGPFDASAVAAVKNIGRLTEMQGMKPSDFAPYRSFKMTFTPEDLAL