Protein Info for Pf6N2E2_5540 in Pseudomonas fluorescens FW300-N2E2

Annotation: Tol biopolymer transport system, TolR protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details PF02472: ExbD" amino acids 11 to 151 (141 residues), 93.6 bits, see alignment E=5.2e-31 TIGR02801: protein TolR" amino acids 14 to 151 (138 residues), 144.5 bits, see alignment E=1.4e-46

Best Hits

Swiss-Prot: 81% identical to TOLR_PSEAE: Tol-Pal system protein TolR (tolR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03560, biopolymer transport protein TolR (inferred from 99% identity to pba:PSEBR_a4437)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2G1 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Pf6N2E2_5540 Tol biopolymer transport system, TolR protein (Pseudomonas fluorescens FW300-N2E2)
MALIARARKKRKPVAEMNVVPYIDVMLVLLVIFMVTAPMLNQGVKVDLPKVSSEALPQDN
NTQVLTISIKADKTYYWNLGSEVDTEKQQDRAMTLPQMTDAVTKIIRVGNDAGKRTQVFI
RGDKTVDYGAVMGAMGGLQKAGVGNVGLITEAP