Protein Info for Pf6N2E2_5538 in Pseudomonas fluorescens FW300-N2E2

Annotation: 4-hydroxybenzoyl-CoA thioesterase family active site

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02799: tol-pal system-associated acyl-CoA thioesterase
  • amino acids 10 to 135 (126 residues), 157.8 bits, E=1.6e-50
• TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family
  • amino acids 13 to 130 (118 residues), 112.5 bits, E=1.4e-36
• PF13279: 4HBT_2
  • amino acids 19 to 137 (119 residues), 59.3 bits, E=5.3e-20
• PF03061: 4HBT
  • amino acids 24 to 107 (84 residues), 56.6 bits, E=2.7e-19

Best Hits

KEGG orthology group: K01075, 4-hydroxybenzoyl-CoA thioesterase [EC: 3.1.2.23] (inferred from 99% identity to pba:PSEBR_a4439)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

MetaCyc Pathways

• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• 4-chlorobenzoate degradation (2/4 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.23

Sequence Analysis Tools

See A0A160A225 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Pf6N2E2_5538 4-hydroxybenzoyl-CoA thioesterase family active site (Pseudomonas fluorescens FW300-N2E2)
MRAQNGLESFAHRCRVYYEDTDAGGIVYYVNYLKFMERARTERLRELGFAQSALAGEDLL
FVVHSSEARYHAPARLDDELLVSADVIELNRVSLRFKQQVRRATDNVLLCEGQFLVACVR
THSLKPRAIPEALRAAFAGVSGAGTHSEQEIKRGS