Protein Info for Pf6N2E2_5529 in Pseudomonas fluorescens FW300-N2E2

Annotation: Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00210: Ferritin
  • amino acids 17 to 156 (140 residues), 90.9 bits, E=3.6e-30

Best Hits

Swiss-Prot: 58% identical to Y1894_SYNY3: Uncharacterized protein slr1894 (slr1894) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K04047, starvation-inducible DNA-binding protein (inferred from 99% identity to pba:PSEBR_a4446)

Predicted SEED Role

"Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1)" in subsystem Oxidative stress (EC 1.16.3.1)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

See A0A160A5X2 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Pf6N2E2_5529 Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1) (Pseudomonas fluorescens FW300-N2E2)
MAIDIGISEEDRKSIVDGLSRLLSDTYVLYLKTHNFHWNVTGPMFRTLHLMFEEQYNELA
LAVDLIAERIRALGFPAPGAYSVYARLSSIKEEEGVPAADDMIRQLVEGQEAVTRTARGI
FPLLDKVSDEPTADLLTQRMQVHEKTAWMLRALLEN