Protein Info for Pf6N2E2_5527 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cold shock protein CspC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details PF00313: CSD" amino acids 134 to 195 (62 residues), 88.8 bits, see alignment E=8.5e-30

Best Hits

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 100% identity to pba:PSEBR_a4447)

Predicted SEED Role

"Cold shock protein CspC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W9T9 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Pf6N2E2_5527 Cold shock protein CspC (Pseudomonas fluorescens FW300-N2E2)
MLKIVHLLMGAAALLLSFIPSLGSEATPYLQHPDALYLAFFGLLNLTLAPVIPYWNKGPR
HQLQNLVSALLVLAVALQTLALLAPMPEIGGQPAILFSLGAALLAVALHLAVSFYKKSSP
AAAAQNYDMSNRDTGTVKWFNTSKGFGFISRDSGDDIFVHFRAIRGEGHRVLVEGQRVEF
SVMNRDKGLQAEDVIAALPRR