Protein Info for Pf6N2E2_5510 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG00955324: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 6 to 309 (304 residues), 167.1 bits, see alignment E=3.3e-53 TIGR00374: TIGR00374 family protein" amino acids 13 to 320 (308 residues), 83.4 bits, see alignment E=1e-27

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a4464)

Predicted SEED Role

"FIG00955324: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3M9 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Pf6N2E2_5510 FIG00955324: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MKRLIWLGAALLTALLVPLLVGGGEMWSRVQRFPLSLLLAMLGMIVLCWTLNSVRLRLLL
GEHRGRIGRLKSIGVVMSTEFAMCATPGGSGGPLTLMALLARNGVRPAHGSAVFAMDQLS
DLLFFLCALVGILFYALFQNLSQRMEWMLGLSAVSMFGGLFACALVARFHRRLILLGARL
LCHLRVKGSTRRRWARKILHFLAAFTDTLKLPRQTLFQVFGLTCLHWALRYSVLYLALKG
LGADLQWAWSFLIQMLSLSAGQFSLLPGGAGAAEVTSAALLAPMVGKSTAAAAILIWRAV
TYYFYLVAGGPVFFLMVGRPLIKKLIKLKQA