Protein Info for Pf6N2E2_5500 in Pseudomonas fluorescens FW300-N2E2

Annotation: MoxR-like ATPases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF20030: bpMoxR" amino acids 26 to 207 (182 residues), 44.6 bits, see alignment E=2.8e-15 PF00158: Sigma54_activat" amino acids 52 to 165 (114 residues), 20.3 bits, see alignment E=1.1e-07 PF07726: AAA_3" amino acids 55 to 185 (131 residues), 217.4 bits, see alignment E=1.6e-68 PF07728: AAA_5" amino acids 55 to 183 (129 residues), 55 bits, see alignment E=2.8e-18 PF00004: AAA" amino acids 56 to 167 (112 residues), 30 bits, see alignment E=2e-10 PF17863: AAA_lid_2" amino acids 254 to 320 (67 residues), 65.9 bits, see alignment E=6.8e-22

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 99% identity to pba:PSEBR_a4473)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A5M0 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Pf6N2E2_5500 MoxR-like ATPases (Pseudomonas fluorescens FW300-N2E2)
MTEQNEPTDGQAHAAQQRQRASQLAQAIRTELRKAVVGQSAVIDDVLTALIAGGHVLLEG
VPGLGKTLLVRALARCFNGEFARIQFTPDLMPSDVTGHAVYDLQTEQFKLRKGPVFTNLL
LADEINRAPAKTQAALLEAMQERQVTLEGRALPISQPFMVLATQNPIEQEGTYPLPEAEL
DRFMLKVRMDYPDADQELDMVRQVSRSTRADMLDVQPLRVVLQAKDVQALQRIASDLPMD
DQVLDYAVRLARTTRSWPGLTLGAGPRASIALVRCARARALLRGGEFVVPDDIKGCAIAV
LRHRVRLAPELDIEGLSVDQVLGQLLDQVPAPRL