Protein Info for Pf6N2E2_5488 in Pseudomonas fluorescens FW300-N2E2

Annotation: C4-dicarboxylate transport sensor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 302 to 321 (20 residues), see Phobius details PF00512: HisKA" amino acids 364 to 428 (65 residues), 27 bits, see alignment E=3.9e-10 PF02518: HATPase_c" amino acids 473 to 581 (109 residues), 77.7 bits, see alignment E=9.4e-26

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 95% identity to pba:PSEBR_a4489)

Predicted SEED Role

"C4-dicarboxylate transport sensor protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H526 at UniProt or InterPro

Protein Sequence (588 amino acids)

>Pf6N2E2_5488 C4-dicarboxylate transport sensor protein (Pseudomonas fluorescens FW300-N2E2)
MLPTTRTLRLSLYTLLILTGAAVAATLAVRHAERVALEEDASRANQQLALYANSLHTLIE
RYRALPAVLALDPELRSALKGPVGAAQQDVLNRKLERINGAAQSSTLELLDHTGLAVAAS
NWRLPSSYVGHNYGFRPYFLQTRTQGTGRFYAVGVTSGIPGYFLSSAVTDDNGEFLGAMV
VKLEFPELEREWRQGSDTLLVSDARSIIFIANRPGWRYRHLQPLSDSDRAELKATRQYDK
QPLQPLAYETLRRFDDNSHLARVETPDGAAEYLWESLPLTAEGWTLHLLRRPQIAFEDRR
NAGLAAAGSWLALVFLLLFLNQRWRLARLRQRSREELERLVEERTRDLRTAQDGLVQSAK
LAALGQMSAALAHEINQPLTAQRMQLATLRLLLDHGRVDDAYKALKPVDDMLTRMAALTG
HLKTFARKSPSGLRERLDLAAVVDQALQLLDTRLRDEQISTVLHLTRPAWVRGDAIRLEQ
VLINLLRNALDAMAEQPIKRLEVRLEADEQLWRLTVSDSGTGIAEEHLAQVFDPFFTTKA
VGDGLGLGLAVSFAIIHESGGRLTADNHEHGAVFCVTLPIDQEAQLHA