Protein Info for Pf6N2E2_5480 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 132.3 bits, see alignment E=4.8e-42 PF08402: TOBE_2" amino acids 274 to 349 (76 residues), 31.6 bits, see alignment E=3.8e-11

Best Hits

Swiss-Prot: 48% identical to AGLK_RHIME: Alpha-glucoside transport ATP-binding protein AglK (aglK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a4497)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H980 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Pf6N2E2_5480 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1) (Pseudomonas fluorescens FW300-N2E2)
MTGLILENVEKHYGSACAVKDVNLHLPEGKLVCFLGPSGCGKTTLLRMIAGLESLSGGEI
RLDGQDIGHTPAHLRNFGMVFQSLALFPHMTVGENIAYPLKLRGVGKAEQQARVVELLEL
IQLQAMIDRPVAKLSGGQRQRVAIARAIAARPKILLLDEPLSALDAKLRESMQVEIRQLQ
QRLNITTILVTHDQREAMTMADIVVVLGEHRVQQVGTPIEIYRHPANEFVADFIGSGNIF
PATTLGNGRVELPGGDALEVPASDSLKVGENIKLLVRPEDLQLSAPQATVGNRLLGKVTF
VRDIGATIETTVECSGISFTALSTPCQGMDLGIGHAVSVTIPAQACRVLAA