Protein Info for Pf6N2E2_5478 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC spermidine/putrescine transporter, inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 12 to 12 (1 residues), see Phobius details amino acids 36 to 37 (2 residues), see Phobius details transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 101 to 142 (42 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 200 to 230 (31 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 281 (201 residues), 56.8 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4499)

Predicted SEED Role

"ABC spermidine/putrescine transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1Z6 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Pf6N2E2_5478 ABC spermidine/putrescine transporter, inner membrane subunit (Pseudomonas fluorescens FW300-N2E2)
MRPPRGISPTGRAWLFLSPSMLFLGVLIAASLLVLRMSVGTKGAEWSGFSLASYEQLLEP
YYLKSLLLTLRLALISAVIAVLLAIPVAYTMSRLASPLLRRVFLAAVLLPLLVNLLLQSY
GWLVILGPAGMLNQALMGLGLIKRPIMLLYNQNGVLMGLVQTAFPLAVLPIASAMRGVAR
SYEEAAATLGASRFQVFRQVVLPMSLPGIITGATLVFAYNASSFVVPLLLGGRRVPMLAV
MVHDQIAPLMNWPAASAAGVVLIVTTLMIMTLSEYFTGRRRRMLEASQ