Protein Info for Pf6N2E2_547 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phophatidylinositol-4-phosphate 5-kinase (EC 2.7.1.68)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF07661: MORN_2" amino acids 47 to 66 (20 residues), 12.5 bits, see alignment (E = 7.5e-06) amino acids 95 to 115 (21 residues), 12.3 bits, see alignment (E = 8.9e-06) amino acids 119 to 140 (22 residues), 11.1 bits, see alignment (E = 2.1e-05)

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a3325)

Predicted SEED Role

"Phophatidylinositol-4-phosphate 5-kinase (EC 2.7.1.68)" (EC 2.7.1.68)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTQ4 at UniProt or InterPro

Protein Sequence (180 amino acids)

>Pf6N2E2_547 Phophatidylinositol-4-phosphate 5-kinase (EC 2.7.1.68) (Pseudomonas fluorescens FW300-N2E2)
MASKRLDVERGDSQLTGQLVDGQLDGPLQIEEAQRPQAKLNYSQGELQGTSTLYHPNGKV
SAVLPFVKGKLQGVASFYAAEGGLQRQATYRRGLLHGEANNYFPDGQLAEAEVYRDGVRD
GRYRRLHPNGNPAVEARYLNGQLLEPAQAYAEDGRPLDAEGKPISRVRWWFRRWNDPAQA