Protein Info for Pf6N2E2_5465 in Pseudomonas fluorescens FW300-N2E2

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 PF00072: Response_reg" amino acids 54 to 152 (99 residues), 35.6 bits, see alignment E=1.3e-12 PF00990: GGDEF" amino acids 192 to 347 (156 residues), 148.9 bits, see alignment E=1.7e-47 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 192 to 350 (159 residues), 120.3 bits, see alignment E=3.4e-39 PF00563: EAL" amino acids 370 to 602 (233 residues), 247.1 bits, see alignment E=2.5e-77

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4513)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZPJ3 at UniProt or InterPro

Protein Sequence (624 amino acids)

>Pf6N2E2_5465 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Pseudomonas fluorescens FW300-N2E2)
MNPMSVPANRRILVVDDTPAIHQDFRKILSPSAGSDDSLDDTESLLFGTPQVSRLQFQID
SAYQGEEALELVKRAQAEGQPYALVFADMRMPPGWDGLQTIERLWEADPRLQIALCTAFS
DYSWETMSERIEFDDQLLILKKPFDTLEIRQMASAMTWKWQLAQDAARKMRSLERTIEER
VQELLKVSHLLQYDVLTELPNSMLLGDRLTQAMAQCRRHDRQLAVMFIGLDRFKRINNAL
GHPVGDEMLKRVARALATVVRESDSVFRYGSDEFVVVLGDIVDPQQTKGVADKLLAAISS
PQPIDGHDLTVTASLGISVYPSDGFDAVALIKKAETAMRNVKETGPNDYRFFTEDMNRRA
RQQQTIESGLRLGLQRKEFVLHYQPKLDLKSGKVVGVEALVRWNRPDHGLVYPSDFIPVA
EDSGLIVPLSQWVLQEACQQACRWQAQGMRPLYLSVNVSAIDFRQRGFVEGIARTLKETG
LAPTQLELEITESVLMQNVDTTVAILKAIKQLGIRLAIDDFGTGYSSLSYLQKFPVDVLK
IDQSFVGDLSIDSNDAKLVSTIISLGKSLNLHIIAEGVETLEQLEFLKKHHCEEVQGYYF
SKAVEPQAFADWMTEWEKRQNPFS