Protein Info for Pf6N2E2_5460 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phage protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 130 to 145 (16 residues), see Phobius details amino acids 154 to 182 (29 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 290 to 315 (26 residues), see Phobius details amino acids 321 to 338 (18 residues), see Phobius details amino acids 349 to 367 (19 residues), see Phobius details PF14264: Glucos_trans_II" amino acids 32 to 335 (304 residues), 63.4 bits, see alignment E=1.2e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A5T3 at UniProt or InterPro

Protein Sequence (503 amino acids)

>Pf6N2E2_5460 Phage protein (Pseudomonas fluorescens FW300-N2E2)
MRITKVLSKKEVLLFFTVASFVYVYPIVHADYAYVDDSWREILAIDDWWRIHGRVLAEVV
TKLMAFNNATINIFPLPLLIATFAFACAMTRLTLWYFPRPEWTACLVVLPLLCNPFFLGN
ISFQYDGPGMMLAVVAAVFSITCHVRNSYLRGCVSAILIAVLLSIYQLVITVFIGLCCME
CLWNVRNGKPAQEVLREIGLRGLQLFFGGGFYYFTAFKLTSDRRGSLAEFDSHWLGEVVR
KFKFSMEKVFELINAGNGFFSILMVIVAGVGYVLVIKNVLALAGGRGEKILVLGACLCVP
PVLIVCVPGPMLFVLDPNLEARNYLGFSVVLFFLLLMSREVLGRAGLRMLLVIPVLAMYS
FSYGYGQVLIAKKELETAMAMFIAYDIIATKEFLNSPVLYYIEPPINGKWLPKAQGAINY
MPALRYLLSSSSMVLRPNTLPQYGINNVVSEGRAAFDAATAEGKTYRRVVDRKFYSFYVT
ESGDFIVMKDLTGSEGYIRGWWR