Protein Info for Pf6N2E2_5441 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG00955104: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 76 PF09905: VF530" amino acids 6 to 67 (62 residues), 120.9 bits, see alignment E=9.9e-40

Best Hits

Swiss-Prot: 62% identical to DNABP_ALIF1: DNA-binding protein VF_0530 (VF_0530) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4533)

Predicted SEED Role

"FIG00955104: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C7DRJ7 at UniProt or InterPro

Protein Sequence (76 amino acids)

>Pf6N2E2_5441 FIG00955104: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MTEPNNNPLHGVTLEQILNALVQHYEWSGLAERIDIRCFKSDPSIKSSLTFLRKTPWARE
KVERLYIKLMRTKRPV