Protein Info for Pf6N2E2_5403 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): ABC transporter for D-Alanine, permease component 2
Rationale: Very important for D-alanine utilization. This transporter may also uptake L-histidine.
Original annotation: Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 66 to 94 (29 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details amino acids 341 to 366 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 66 to 129 (64 residues), 55.9 bits, see alignment E=2.4e-19 PF00528: BPD_transp_1" amino acids 175 to 370 (196 residues), 60.2 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 63% identical to YHDX_ECOLI: Putative amino-acid ABC transporter permease protein YhdX (yhdX) from Escherichia coli (strain K12)

KEGG orthology group: K09970, general L-amino acid transport system permease protein (inferred from 99% identity to pba:PSEBR_a4576)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3G2 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Pf6N2E2_5403 ABC transporter for D-Alanine, permease component 2 (Pseudomonas fluorescens FW300-N2E2)
VRAWVFQVVTVVAVIALGWFLFDNTQTNLQHRGITSGFGFLERSAGFGIAQHLIDYTEAD
SYARVFLIGLLNTLLVTFIGVILATILGFIIGVARLSQNWIISKLATVYVEVFRNIPPLL
QILFWYFAVFLSMPGPRAAHNFGDTFFVSSRGLNMPAALVAEGFWPFVISVVLAIVAIVL
MTRWANKRFEATGEPFHKFWVGLALFLVIPALSALLFGAPVHWEMPELKGFNFVGGWVLI
PELLALTLALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVIIPQALRVI
IPPLTSQYLNLAKNSSLAAGIGYPEMVSLFAGTVLNQTGQAIEVIAITMSVYLAISISIS
LLMNWYNKRIALIER