Protein Info for Pf6N2E2_5394 in Pseudomonas fluorescens FW300-N2E2

Annotation: Molybdenum cofactor biosynthesis protein MoaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02391: MoaE
  • amino acids 8 to 119 (112 residues), 125.6 bits, E=5.7e-41

Best Hits

Swiss-Prot: 82% identical to MOAE_PSEAE: Molybdopterin synthase catalytic subunit (moaE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 99% identity to pba:PSEBR_a4584)

MetaCyc: 63% identical to molybdopterin synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (4/6 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.1.12

Sequence Analysis Tools

See A0A160A3L6 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Pf6N2E2_5394 Molybdenum cofactor biosynthesis protein MoaE (Pseudomonas fluorescens FW300-N2E2)
MAIRVQVAPFDAGGEVNAMHAANVGVGAVVSFVGYVRDFNDGLDVSGMFLEHYPGMTEKA
LGKIASEAEQRWPLLKLEVLHRIGALEPGEPIVFVGAASAHRQAAFDACAFVMDYLKTRA
PFWKKENTVDGPRWVEGRDSDHAAADRWKQ