Protein Info for Pf6N2E2_5387 in Pseudomonas fluorescens FW300-N2E2

Annotation: Alginate biosynthesis protein Alg8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 43 to 70 (28 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 426 to 444 (19 residues), see Phobius details amino acids 472 to 492 (21 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 86 to 342 (257 residues), 143.6 bits, see alignment E=9.2e-46 PF13632: Glyco_trans_2_3" amino acids 183 to 404 (222 residues), 93.2 bits, see alignment E=2.1e-30

Best Hits

Swiss-Prot: 90% identical to ALG8_PSESM: Glycosyltransferase alg8 (alg8) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4591)

MetaCyc: 83% identical to mannuronosyl transferase catalytic subunit (Pseudomonas aeruginosa)
Alginate synthase. [EC: 2.4.1.33]

Predicted SEED Role

"Alginate biosynthesis protein Alg8" in subsystem Alginate metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZPB7 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Pf6N2E2_5387 Alginate biosynthesis protein Alg8 (Pseudomonas fluorescens FW300-N2E2)
MHRLKHGLLQAAGWLFYLSLLMGIAMALPTSTFDSESKDFIFLIGAVGIWRYSMGATHFV
RGMIFLYIVYPHLRRKVRKLGKAADPSHVYLMVTSFRIDALTTAQVYGSVIREAIECGLP
TTVVCSIVEMSDELLVKSLWARMNPPARVKLDFVRIPGTGKRDGLAYGFRAISRHLPDDR
AVVAVIDGDTVLAEGVVRKTVPWFQLFGNVGGLTTNEFCEVRGGYIMSEWHKLRFAQRHI
NMCSMALSKRVLTMTGRMSVFRATVVTNPDFIADVESDSLQHWRLGRFKFLTGDDKSSWF
SLMRLGYDTFYVPDAAINTVEHPPEKSFIKASRKLMFRWYGNNLRQNSRALGLGLRRLGL
FTSVVLLDQRVSMWTSLLGLTVALIASFKYGTAFILVYLLWIGITRLLLTLLLSCSGHKI
GPAYPAILYYNQIVGALVKIYVFFRLDQQSWTRQPTSLTRDLASFQRWFNTWSSRTMTFS
AGSIFVAVLLTMV