Protein Info for Pf6N2E2_5374 in Pseudomonas fluorescens FW300-N2E2

Annotation: Membrane fusion component of tripartite multidrug resistance system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 43 to 226 (184 residues), 116.9 bits, see alignment E=4.7e-38 PF25917: BSH_RND" amino acids 44 to 183 (140 residues), 56.5 bits, see alignment E=4e-19 PF25878: HH_AAEA_pHBA" amino acids 78 to 148 (71 residues), 38.9 bits, see alignment E=2e-13 PF25963: Beta-barrel_AAEA" amino acids 186 to 281 (96 residues), 116.3 bits, see alignment E=1.1e-37

Best Hits

Swiss-Prot: 46% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4604)

MetaCyc: 40% identical to aromatic carboxylic acid efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-233

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1S5 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Pf6N2E2_5374 Membrane fusion component of tripartite multidrug resistance system (Pseudomonas fluorescens FW300-N2E2)
MRKFFSLLATLLVLALALWIGRTLWVHYMNEPWTRDGRIRADIINVAADVSGEVVEVPVR
DNQSVKKGDLLMRIDPEHYRIAVKQARSLVASRKATWEMRKVNAHRRADLDSLVISRENR
DDASNIADSALADYQQAQAQLEAAELNLSRTEVRAAVDGYVTNLNVHRGDYARIGEAKMA
VVDMNSFWVYGFFEETKLPKVRVGDSAQLQLMSGEMLKGHVESISRGIYDRDNPESRELI
ADVNPTFNWVRLAQRVPVRIHLDEVPDGVLLAAGMTCTVVVEPQTER