Protein Info for Pf6N2E2_5362 in Pseudomonas fluorescens FW300-N2E2

Annotation: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR00325: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase" amino acids 2 to 298 (297 residues), 395.4 bits, see alignment E=8.2e-123 PF03331: LpxC" amino acids 4 to 275 (272 residues), 373.2 bits, see alignment E=4.2e-116

Best Hits

Swiss-Prot: 99% identical to LPXC_PSEF5: UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 99% identity to pfl:PFL_5055)

MetaCyc: 56% identical to UDP-3-O-acyl-N-acetylglucosamine deacetylase (Escherichia coli K-12 substr. MG1655)
UDPACYLGLCNACDEACETYL-RXN [EC: 3.5.1.108]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)" (EC 3.5.1.108)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D0MVV0 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Pf6N2E2_5362 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108) (Pseudomonas fluorescens FW300-N2E2)
MIKQRTLKNIIRATGVGLHSGEKVYLTLKPAPVDTGIVFCRADLDPVVQIPARAENVGET
TMSTTLVNGDTKVDTVEHLLSAMAGLGIDNAYVELSASEVPIMDGSAGPFVFLIQSAGLE
EQDAAKKFIRILREVTVEDGDKRATFVPFEGFKVSFEIDFDHPVFRDRTQSASVDFSSTS
FVKEVSRARTFGFMSDIEYLRKHNLALGGSVENAIVVDSDGVLNEDGLRYEDEFVKHKIL
DAIGDLYLLGNSLIGEFKGFKSGHALNNQLLRKLIEQKDAWEVVTFEDASTAPISYMRPV
AAV