Protein Info for Pf6N2E2_5355 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cell division protein FtsW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details transmembrane" amino acids 61 to 82 (22 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 157 to 173 (17 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details TIGR02614: cell division protein FtsW" amino acids 25 to 380 (356 residues), 429.4 bits, see alignment E=5.4e-133 PF01098: FTSW_RODA_SPOVE" amino acids 28 to 382 (355 residues), 338.5 bits, see alignment E=2.2e-105

Best Hits

Swiss-Prot: 95% identical to FTSW_PSEFS: Probable peptidoglycan glycosyltransferase FtsW (ftsW) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03588, cell division protein FtsW (inferred from 99% identity to pba:PSEBR_a4622)

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3P2 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Pf6N2E2_5355 Cell division protein FtsW (Pseudomonas fluorescens FW300-N2E2)
MSLMNIIKPYPSPLITGRGIDLDFPMLAGCLALLGLGLVMITSASSEVAAVQSGNTLYHM
IRHLIYLVIGLGACIVTMMVPIATWQRLGWMMLLGAFGLLVMVLVPGIGREVNGSMRWIG
FSFFNVQPSEIAKVFVVIFLAGYLVRRQKEVRESWMGFFKPFIVLLPMAGLLLMEPDFGA
TVVMMGAAAAMLFLGGVGLFRFILMVALAVAAVTVLVQAQPYRMARLITFTDPWADQFGS
GYQLTQALIAFGRGEWLGVGLGNSVQKQFYLPEAHTDFVFSVLAEELGVVGSLCTVALFV
FVCVRGMYIGLWAEKAKQFFAAYVAYGLSFLWIGQFLINIGVNVGLLPTKGLTLPFLSYG
GSSLVICCACLGLLLRIEWESRTHLGSEEMEFQESDFAEEPIHGR