Protein Info for Pf6N2E2_5343 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phosphoheptose isomerase (EC 5.3.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 14 to 146 (133 residues), 116.5 bits, E=9.5e-38
• PF01380: SIS
  • amino acids 88 to 154 (67 residues), 26.9 bits, E=3.8e-10

Best Hits

Swiss-Prot: 100% identical to GMHA_PSEPF: Phosphoheptose isomerase (gmhA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 100% identity to pfs:PFLU0933)

MetaCyc: 48% identical to D-sedoheptulose 7-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (3/5 steps found)
• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Galactose metabolism
• Inositol phosphate metabolism
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

See A0A0C2AAJ0 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Pf6N2E2_5343 Phosphoheptose isomerase (EC 5.3.1.-) (Pseudomonas fluorescens FW300-N2E2)
MDMQSRIRQLFQASIDTKQQAMDVLAPHIEQASQVMVNALLNEGKMLSCGNGGSAGDAQH
FSSELLNRFERERPSLPAIALTTDSSTITSIANDYSYNEVFSKQIRALGQPGDVLLAIST
SGNSANIIQAIQAAHDREMIVVALTGRDGGGMASLLLPEDVEIRVPANVTARIQEVHLLA
IHCLCDLIDSQLFGSEE