Protein Info for Pf6N2E2_5339 in Pseudomonas fluorescens FW300-N2E2

Annotation: ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 233 to 251 (19 residues), see Phobius details PF02167: Cytochrom_C1" amino acids 35 to 154 (120 residues), 23.8 bits, see alignment E=1.6e-09 amino acids 204 to 258 (55 residues), 24.5 bits, see alignment E=9.8e-10

Best Hits

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 99% identity to pba:PSEBR_a4637)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GLR4 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Pf6N2E2_5339 ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit (Pseudomonas fluorescens FW300-N2E2)
MKKLFAVLILAAMPVLSFAAEHGGPELEKVDIDVSDKAAMQDGARTFANYCMGCHSAKFQ
RYERVADDLGIPHEVMLEKLVFTGAKLGDHMTIGMQPADAKTWFGAAPPDLTLVARVRGT
DWLYGYLRSFYEDPARPWGVNNKVFPNVGMPNVLVGLQGRQVVGCKQVQIVEGGKKQFDP
LTGTALTHEACDQLTVLPNTGSLTPEQFDEKVKNLVTFLAYSANPVKLEHQRIGTYVLLY
LAFFFVFAYLLKREYWKDVH