Protein Info for Pf6N2E2_5324 in Pseudomonas fluorescens FW300-N2E2

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR00229: PAS domain S-box protein" amino acids 35 to 158 (124 residues), 42.9 bits, see alignment E=5.1e-15 PF00989: PAS" amino acids 37 to 143 (107 residues), 27.5 bits, see alignment E=5.2e-10 PF08447: PAS_3" amino acids 57 to 145 (89 residues), 87.8 bits, see alignment E=9.6e-29 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 193 to 348 (156 residues), 131 bits, see alignment E=3.5e-42 PF00990: GGDEF" amino acids 195 to 347 (153 residues), 140.1 bits, see alignment E=1.2e-44

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a4664)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A5J0 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Pf6N2E2_5324 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Pseudomonas fluorescens FW300-N2E2)
LDEHFDIKADGETTMGDASNIDMLRFDLSDLDEGVLHTILELVSDGIWDWNASTGFVYRN
PGWYTMLGYLPHSLDNNVLTWESVIHPDDYPRVMALFDDYLEQRSHGYQAEYRCRTRDGT
YIWIEDRGYVIARNPDGTVARMIGAHRSIDDKKRLFEQLEQRNKSLEAIIEERTRELSRV
NHQLQIQLDENRRLAETDALTRVANRYRLEQALPLACERAQRFREPLSLIAMDVDDFKDI
NDRYGHAFGDAALVQVVQSVKRCQRDGDLLVRWGGDEFIMILPNTTLADARLLAESIRRG
LSDLLPVGDFQITMSFGVVQRLENEQHATLLHRADQALYRSKMSGKNVICE