Protein Info for Pf6N2E2_5314 in Pseudomonas fluorescens FW300-N2E2

Annotation: Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF13185: GAF_2" amino acids 25 to 159 (135 residues), 34.6 bits, see alignment E=9.6e-12 PF01590: GAF" amino acids 26 to 159 (134 residues), 52.3 bits, see alignment E=4.1e-17 PF00158: Sigma54_activat" amino acids 194 to 360 (167 residues), 235 bits, see alignment E=1.9e-73 PF14532: Sigma54_activ_2" amino acids 195 to 365 (171 residues), 64.4 bits, see alignment E=6.6e-21 PF07728: AAA_5" amino acids 218 to 336 (119 residues), 33.2 bits, see alignment E=2.3e-11 PF00004: AAA" amino acids 218 to 343 (126 residues), 25 bits, see alignment E=1e-08 PF25601: AAA_lid_14" amino acids 366 to 425 (60 residues), 47.1 bits, see alignment E=8e-16 PF02954: HTH_8" amino acids 475 to 510 (36 residues), 26.9 bits, see alignment 1.5e-09

Best Hits

Swiss-Prot: 49% identical to LUXO_VIBC3: Regulatory protein LuxO (luxO) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 98% identity to pba:PSEBR_a4676)

Predicted SEED Role

"Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A5I4 at UniProt or InterPro

Protein Sequence (518 amino acids)

>Pf6N2E2_5314 Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR (Pseudomonas fluorescens FW300-N2E2)
MTATALLTSLLPLVADLSRELPEGERYRRLLGTLRALLPCDAAALLRLDGDCLVPLAVDG
LSTDTLGRRFRVSEHPRFEALLANPQPTRFAADSGLPDPYDGLVEGLAEHLEVHDCMGCP
LFVDERPWGLLTLDSLDPERFEPIDLSALQAFASLAAATVSAAERIERLALKAEDEHRRA
EVYRQASGQQPRDMVGQSKAHKRLVEEITLVGSSDLTVLITGETGVGKELVAQAIHAASE
RAEQPLISLNCAALPDTLVESELFGHVRGAFTGATNDRRGKFELADGGTLFLDEVGELSL
AVQAKLLRVLQSGQLQRLGSDKEHRVDVRLIAATNRDLAEEVRNGRYRADFYHRLSVYPL
QVPALRDRGRDVLLLSGFFLEHNRSRMGLGSLRLTGDAQAALLAYDWPGNVRELEHLIGR
SALKALGRCATRPKILSLSAQDLDLPQAPVDNPTPSSISPASTAQGVTGDLREAVDEFQR
TLIAACLERHQHNWASAARELGLDRANLGRMARRLGLK