Protein Info for Pf6N2E2_5286 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG002188: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07044: DUF1329" amino acids 83 to 450 (368 residues), 510.5 bits, see alignment E=1.6e-157

Best Hits

Swiss-Prot: 70% identical to Y3922_PSEAE: Uncharacterized protein PA3922 (PA3922) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4700)

Predicted SEED Role

"FIG002188: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A377 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Pf6N2E2_5286 FIG002188: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MRKMILQCGALALSLLAANVMAAVSPDEANKLGTSLTPLGAEKAGNADGSIPAWTGGIPK
NAGAVDSKGFLADPFANEKPLFTITAATVDKYKDKLSEGQVAMFKRYPETYKIPVYPTHR
SVGLPPEIYESAKRSALNVNAINDGNGLANFTGNRYYAFPIPKSGVEVLWNHVTRYHGGN
LRRVITQVTPQTNGSFTPIRFEEEIAVPFLIKDADPEKASNVLTYFKQEVTAPARLAGNV
LLVHETLDQVKEPRLAWIYNAGQRRVRRAPQVAYDGPGTAADGLRTSDNFDLFSGAPDRY
DWKLVGKKEMYIPYNSYKLDSPSLKYDDVIKAGHINQDLTRYELHRVWEVVGTVKPSERH
IYAKRHMYIDEDSWQAALVDHYDGRGQLWRVAEGHAQFYYDHQNPGYTLEALYDIIAGRY
IALGMKNEEKHSYEYGFEARAADYTPAALRSTGVR