Protein Info for Pf6N2E2_5274 in Pseudomonas fluorescens FW300-N2E2

Annotation: FolM Alternative dihydrofolate reductase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00106: adh_short" amino acids 8 to 179 (172 residues), 86.5 bits, see alignment E=1.8e-28 PF13561: adh_short_C2" amino acids 12 to 234 (223 residues), 82.5 bits, see alignment E=3.7e-27

Best Hits

Swiss-Prot: 50% identical to FOLM_KLEP7: Dihydromonapterin reductase (folM) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K13938, dihydromonapterin reductase / dihydrofolate reductase [EC: 1.5.1.- 1.5.1.3] (inferred from 96% identity to pba:PSEBR_a4711)

MetaCyc: 46% identical to dihydromonapterin reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6367 [EC: 1.5.1.50]; Dihydrofolate reductase. [EC: 1.5.1.50, 1.5.1.3]

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-, 1.5.1.3

Use Curated BLAST to search for 1.5.1.- or 1.5.1.3 or 1.5.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3H4 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Pf6N2E2_5274 FolM Alternative dihydrofolate reductase 1 (Pseudomonas fluorescens FW300-N2E2)
MSSATAPILITGAAQRVGLHCARRLLEDGQPVIATYRTERPGVQTLRDLGAVMLFADFSS
EAGILAFIEQLKQHTDRLRAIVHNASAWLAEGPGCEAAAFKAMFGVHMLAPYLINLHGAE
LLRRSTPADIVHISDDVTRKGSARHIAYCATKAGLESLTLSFAAKFAPAIKVNGIAPALL
LFNPEDDAAYRAKALAKSALGIEPGSEVIYQSLRYLLDNPYVTGTTLTVNGGRHVK