Protein Info for Pf6N2E2_5272 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dihydroneopterin triphosphate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 TIGR00526: FolB domain" amino acids 8 to 122 (115 residues), 108 bits, see alignment E=1.8e-35 PF02152: FolB" amino acids 11 to 119 (109 residues), 90.8 bits, see alignment E=4.5e-30

Best Hits

Swiss-Prot: 61% identical to FOLX_SHIFL: Dihydroneopterin triphosphate 2'-epimerase (folX) from Shigella flexneri

KEGG orthology group: K07589, D-erythro-7,8-dihydroneopterin triphosphate epimerase [EC: 5.-.-.-] (inferred from 92% identity to pfl:PFL_0948)

MetaCyc: 61% identical to dihydroneopterin triphosphate 2'-epimerase (Escherichia coli K-12 substr. MG1655)
H2NTPEPIM-RXN [EC: 5.1.99.7]

Predicted SEED Role

"Dihydroneopterin triphosphate epimerase" in subsystem Folate Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.1.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZNW0 at UniProt or InterPro

Protein Sequence (126 amino acids)

>Pf6N2E2_5272 Dihydroneopterin triphosphate epimerase (Pseudomonas fluorescens FW300-N2E2)
MPQLQPAMARIKVKDLRLRTFIGINEDEILNKQDVLINLTILYAAQEAVRDNDIDHALNY
RTITKAIIAHVEGNRFALLERLTQELLDLVMTNESVQYAEVEVDKPHALRFAESVSITLA
ASRATS