Protein Info for Pf6N2E2_5239 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 346 to 394 (49 residues), see Phobius details amino acids 407 to 436 (30 residues), see Phobius details amino acids 496 to 511 (16 residues), see Phobius details PF00916: Sulfate_transp" amino acids 25 to 409 (385 residues), 278.3 bits, see alignment E=8.9e-87 PF01740: STAS" amino acids 462 to 549 (88 residues), 59.2 bits, see alignment E=3.2e-20

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 98% identity to pba:PSEBR_a4741)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTW1 at UniProt or InterPro

Protein Sequence (580 amino acids)

>Pf6N2E2_5239 Putative sulfate permease (Pseudomonas fluorescens FW300-N2E2)
MSFSAPPLFAAWRQAWRAGYTLERLRGDLVAGLTVGIIAIPLAMALAIAVGVPPQHGLYT
VLVAAPLIALTGGSRFNVSGPTAAFVVILLPITQQHGLGGLLLCTMLAGLILITLGLMRA
GRLIQYIPYPVILGFTAGIGVVIATLQLKDLLGLTTVGQAKHYIEQLGELIVALPSARLG
DGIIGVTCLAVLFAWPRWVPRVPGHLVALLVGALLGLALERGGWPVATLGERFSYMVDGI
SHPGIPPFLPSFEWPWNLPDGQGHPLTLSYDLIRQLLGPAFAIAMLGAIESLLCAVVADG
MTGSKHDPNAELIGQGLGNLVAPLFGGITATAAIARSATNVRSGASSPLAAIIHSLVVLL
AMVLLAPLFSYLPMAALAALLVIVAWNMSEAGHVLHTLRIAPRSDVLVLLTCLSLTVLFD
MVMAVAVGLLLAAGLFIKRMSELTDSAELPRHFHQALLDMPEHVRCYAIRGPLFFGAAEK
ALDVLRKFDPGVRVVVVEMSAVPMLDMTALAAFENILKDYRKQGIGLILVATAPRVRLKL
RRAGIHREQRQLAYVQTLEQARVKSEQWLASGSNAHPRLA