Protein Info for Pf6N2E2_5238 in Pseudomonas fluorescens FW300-N2E2

Annotation: Tryptophan synthase beta chain like (EC 4.2.1.20)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR04366: cupin fold metalloprotein, WbuC family" amino acids 7 to 138 (132 residues), 147.2 bits, see alignment E=1.3e-47 PF19480: DUF6016" amino acids 7 to 85 (79 residues), 35.1 bits, see alignment E=8.7e-13

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a4742)

Predicted SEED Role

"Tryptophan synthase beta chain like (EC 4.2.1.20)" (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1H4 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Pf6N2E2_5238 Tryptophan synthase beta chain like (EC 4.2.1.20) (Pseudomonas fluorescens FW300-N2E2)
MTRPSFLDHALFDGLAEKAAASPRGRQHHNFHEMDEPCHRMAVGLQPSTYIPPHRHLSAD
KAETLLVLKGRLGILIFDEAGAVVDKRILQAGGDCLGVDLPAGVYHGLVVLEADSLMFEC
KAGPYRPVGEGELAHWAPREGEPGVAEYRAWMRAQFD