Protein Info for Pf6N2E2_5234 in Pseudomonas fluorescens FW300-N2E2

Annotation: Uracil permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 39 to 55 (17 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 10 to 407 (398 residues), 370.5 bits, see alignment E=5.8e-115 PF00860: Xan_ur_permease" amino acids 12 to 379 (368 residues), 318.2 bits, see alignment E=3.2e-99

Best Hits

Swiss-Prot: 60% identical to URAA_PASMU: Probable uracil permease (uraA) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02824, uracil permease (inferred from 99% identity to pba:PSEBR_a4745)

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GLP9 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Pf6N2E2_5234 Uracil permease (Pseudomonas fluorescens FW300-N2E2)
MQDEFNDPLWRQVLSGAQMLFVAFGALVLMPLITGLDPNVALFTAGLGTILFQIVTGRQV
PVFLASSFAFITPIILAKGQFGLAATMGGVMAAGFVYTFLGLAVKIKGTGFIDRLLPPVV
IGPVIISIGLAMAPIAANMAMGKAGDGTELIHYQTAMMISMPALLTTLIVAVFGKGIFRL
VPIISGVLVGFAMAFFFGVVDTAKIAAAPWFALPAFTAPEFNWQAILFIVPVALAPAIEH
IGGVIAVGSVTGRDYLKKPGLHRTLLGDGIATTAAGLFGGPPNTTYAEVTGAVMLTKNYN
PKIMTWAAIFAISLAFIGKFGALLQSIPVPVMGGILCLLFGSIAAVGMNTLIRHKIDLGE
ARNLVIVSVTLVFGIGGVLVGTGTGPDDFGLKGIALCAVVAIALNLLLPGNDSWKQKKAD
EPLL