Protein Info for Pf6N2E2_5232 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cell division inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF01370: Epimerase" amino acids 3 to 221 (219 residues), 113.7 bits, see alignment E=9.7e-37 TIGR01777: TIGR01777 family protein" amino acids 3 to 292 (290 residues), 350.7 bits, see alignment E=3.9e-109 PF08338: DUF1731" amino acids 249 to 295 (47 residues), 62.5 bits, see alignment 2.5e-21

Best Hits

Swiss-Prot: 40% identical to Y1921_STAS1: Epimerase family protein SSP1921 (SSP1921) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: K07071, (no description) (inferred from 98% identity to pba:PSEBR_a4747)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A4C4 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Pf6N2E2_5232 Cell division inhibitor (Pseudomonas fluorescens FW300-N2E2)
MHILLTGGTGLIGRQLCRLWLGQGHRLTVWSRRPEEVAKICGADVRGVARLDEVVEPVDA
VVNLAGAPIADRPWSHKRKMLLWSSRITLTEVLLAWLERCEQKPQVLISGSAVGWYGDGG
ERELTEESGPVSEDFASQLCIAWEETAQRAEALGIRVVLVRTGLVLSAEGGFLSRLRLPF
KLALGGRIGNGRQWMPWIHIDDQIALIDFLLHRFDASGPYNACAPNPVRNRDFAKALGHV
LHRPAVVPMPELALKVALGELSLLLLGGQRATPARLQAAGFTFRFTDLPAALEDLSSRL