Protein Info for Pf6N2E2_5219 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG140336: TPR domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13432: TPR_16" amino acids 217 to 267 (51 residues), 20.6 bits, see alignment 4.7e-07 amino acids 257 to 300 (44 residues), 17 bits, see alignment 6.2e-06 amino acids 297 to 340 (44 residues), 18.9 bits, see alignment 1.5e-06 amino acids 467 to 519 (53 residues), 19.6 bits, see alignment 9.3e-07 amino acids 493 to 553 (61 residues), 27.1 bits, see alignment E=4.3e-09 PF14559: TPR_19" amino acids 228 to 286 (59 residues), 40 bits, see alignment 3.3e-13 amino acids 467 to 523 (57 residues), 35.5 bits, see alignment 8.6e-12 amino acids 499 to 554 (56 residues), 26.7 bits, see alignment 4.9e-09 PF07719: TPR_2" amino acids 487 to 518 (32 residues), 23 bits, see alignment (E = 5.1e-08) PF13374: TPR_10" amino acids 489 to 515 (27 residues), 20.1 bits, see alignment (E = 4.5e-07) PF13181: TPR_8" amino acids 491 to 518 (28 residues), 13.7 bits, see alignment (E = 5e-05) PF07721: TPR_4" amino acids 491 to 511 (21 residues), 13.6 bits, see alignment (E = 7.6e-05) amino acids 521 to 542 (22 residues), 10.2 bits, see alignment (E = 0.00092) PF13174: TPR_6" amino acids 492 to 518 (27 residues), 15.5 bits, see alignment (E = 1.8e-05)

Best Hits

Swiss-Prot: 70% identical to Y4667_PSEAE: TPR repeat-containing protein PA4667 (PA4667) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4760)

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A330 at UniProt or InterPro

Protein Sequence (568 amino acids)

>Pf6N2E2_5219 FIG140336: TPR domain protein (Pseudomonas fluorescens FW300-N2E2)
LLLALALLSGCQSMAPVSTDGTPPVEDSVQAPEKPKVYGSFSEETIFSLLSAELAGQRNR
FDIALDNYVTQAINTQDPGISERAFRIAEYLGADQPALDTALIWARNAPDDLEAQRAAAV
QLARAGRYDDSMVYMEKVLLGKGDTHFDFLALSAADTDQETRNGLMKSFDRLLQRHPNNG
QLIFGKALLLQQDGDTQGALTLLEDNPPEAGEVAPILLRARLLQGLNRGDEALPLLEKSI
KKYPDDKRLRLTYARMLVENNRMDDAKVEFSSLVQQYPEDDELRYSLALVCLEAKAWEEA
KGYLEDLIARESHVDSAHLNLGRIAEERNDPESALIEYAQVGPGNDYLPAQLRQADILMG
NGKTAEAQSRLAVQRDSQPDYGIQLYLIEAETLSANNQGDKAWNVLQQALKQYPDDLNLL
YTRAMLAEKRNDLAQMEKDLRLIIQRDPDNAMALNALGYTLSDRTTRYDEAKVLIEQAHQ
INPEDPAVLDSLGWVNFRLGNLDEAERLLRQALERFPDQEVAAHLGEVLWANGKQREARQ
IWSKFLKDQPDSPILRSTIKRLTGSETL