Protein Info for Pf6N2E2_5210 in Pseudomonas fluorescens FW300-N2E2

Annotation: Possible carboxymuconolactone decarboxylase family protein (EC 4.1.1.44)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 PF02627: CMD" amino acids 37 to 103 (67 residues), 61.5 bits, see alignment E=3e-21 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 40 to 88 (49 residues), 51.7 bits, see alignment E=2.3e-18

Best Hits

Swiss-Prot: 41% identical to Y1053_HAEIN: Uncharacterized protein HI_1053 (HI_1053) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 68% identity to mms:mma_0914)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZNM8 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Pf6N2E2_5210 Possible carboxymuconolactone decarboxylase family protein (EC 4.1.1.44) (Pseudomonas fluorescens FW300-N2E2)
MMNWNEYFAGLMGNVSEFAKLAPETMRGLHTIGSAPAKHLEPKIHELIALSVAITTRCDG
CIASHVQAALKHDATREEIAEALGVAISLNAGAALTYTARVFDAVSAFEKH