Protein Info for Pf6N2E2_5155 in Pseudomonas fluorescens FW300-N2E2

Annotation: Poly(A) polymerase (EC 2.7.7.19)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 307 to 326 (20 residues), see Phobius details TIGR01942: poly(A) polymerase" amino acids 25 to 458 (434 residues), 630.3 bits, see alignment E=7.4e-194 PF01743: PolyA_pol" amino acids 56 to 189 (134 residues), 141.5 bits, see alignment E=2.8e-45 PF12627: PolyA_pol_RNAbd" amino acids 216 to 277 (62 residues), 66.3 bits, see alignment E=2.6e-22 PF12626: PolyA_pol_arg_C" amino acids 332 to 448 (117 residues), 149.7 bits, see alignment E=5.4e-48

Best Hits

Swiss-Prot: 48% identical to PCNB_HAEIN: Poly(A) polymerase I (pcnB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a4814)

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1C9 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Pf6N2E2_5155 Poly(A) polymerase (EC 2.7.7.19) (Pseudomonas fluorescens FW300-N2E2)
MLKKLFQSFRSPLRRTQHIRSTPEVLNSGQHSLQKAQFSRYAVNIVERLQNAGYQAYLVG
GCVRDMLLNITPKDFDVATSATPEQIRAEFRNARIIGRRFKLVHIHFGREIIEVATFRAN
HPQNDEEEDSNQSSRNESGRILRDNVYGTLEEDAQRRDFTINALYYDPVSERILDYANGV
HDIRNRLIRLIGDPKQRYQEDPVRMLRAVRFAAKLDFGIEKHSALPIRELAPMLREIPSA
RLFEEVLKLFLSGNAADTFEMLVDLQLFDPLFPASAEALEHNPTYTHTLISEALINTDLR
IKQNKPVTPAFLFAALLWPALPARVLRLQERGMPPIPAMQEAAHELIAEQCQRIAIPKRF
TMPIREIWDMQERLPRRSGKRADLLLDNPRFRAGYDFLLLRESAGEQTDGLGEWWTDYQD
ANDSERRDMIRELSGKDDGASGPRKRRRSSGAKRKRAGVPSASGE