Protein Info for Pf6N2E2_514 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): 5-deoxy-D-glucuronate isomerase (EC 5.3.1.30)
Rationale: Specifically important for utilizing m-Inositol.
Original annotation: 5-deoxy-glucuronate isomerase (EC 5.3.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR04378: 5-deoxy-glucuronate isomerase" amino acids 20 to 266 (247 residues), 312.1 bits, see alignment E=1.4e-97 PF04962: KduI" amino acids 20 to 266 (247 residues), 333.6 bits, see alignment E=4.2e-104

Best Hits

Swiss-Prot: 52% identical to IOLB_LISMO: 5-deoxy-glucuronate isomerase (iolB) from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 99% identity to pba:PSEBR_a3354)

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.- or 5.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTN4 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Pf6N2E2_514 5-deoxy-D-glucuronate isomerase (EC 5.3.1.30) (Pseudomonas fluorescens FW300-N2E2)
MSLLIKSHSSGRTMVQLPAGELEYVGFAAYRLSLGETLPVAADDKELCLVLLSGRISLKG
EAPGQGAFDWDNLGDRQSVFEDKSPYAAYLPPGSQAQVTALSDVQIAVCAAPGSAQNSYG
PRLIRPDSMKRSVRGKGANTRYVCDILPDSEPAHSLLVVEVRTPSGHSSSYPPHKHDTDD
LPHQSFLEETYYHQVNPSQGFVFQRVYTDDRSIDQAMAVENSDLVVVPKGYHPVSVPYGY
ESYYLNVMAGPKRVWQFHNDPQHSWLLDL