Protein Info for Pf6N2E2_5073 in Pseudomonas fluorescens FW300-N2E2

Annotation: Large-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details TIGR00220: large conductance mechanosensitive channel protein" amino acids 4 to 133 (130 residues), 158.6 bits, see alignment E=4.3e-51 PF01741: MscL" amino acids 4 to 131 (128 residues), 156.5 bits, see alignment E=2e-50

Best Hits

Swiss-Prot: 92% identical to MSCL_PSEFS: Large-conductance mechanosensitive channel (mscL) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 100% identity to pba:PSEBR_a4891)

MetaCyc: 65% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9XA88 at UniProt or InterPro

Protein Sequence (137 amino acids)

>Pf6N2E2_5073 Large-conductance mechanosensitive channel (Pseudomonas fluorescens FW300-N2E2)
MGVLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVVMPPIGLLIGGVDFSDLAIT
LKAAQGDAPAVVLAYGKFIQSTIDFIIVAFAIFMGVKAINRLKREEAVAPSAPPVPTKEE
LLLSEIRDLLKAQNERP