Protein Info for Pf6N2E2_507 in Pseudomonas fluorescens FW300-N2E2

Annotation: Hydrogen cyanide synthase HcnB / Opine oxidase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF00890: FAD_binding_2" amino acids 4 to 39 (36 residues), 29.9 bits, see alignment 1.6e-10 PF07992: Pyr_redox_2" amino acids 6 to 310 (305 residues), 67.1 bits, see alignment E=8.5e-22 PF01494: FAD_binding_3" amino acids 6 to 33 (28 residues), 27.7 bits, see alignment (E = 7.4e-10) PF12831: FAD_oxidored" amino acids 6 to 42 (37 residues), 31.9 bits, see alignment 4.2e-11 PF13450: NAD_binding_8" amino acids 7 to 60 (54 residues), 44.6 bits, see alignment 6.3e-15 PF01593: Amino_oxidase" amino acids 13 to 42 (30 residues), 20.2 bits, see alignment (E = 1.5e-07) PF04324: Fer2_BFD" amino acids 382 to 426 (45 residues), 31.4 bits, see alignment 9e-11

Best Hits

Swiss-Prot: 79% identical to HCNB_PSEPH: Hydrogen cyanide synthase subunit HcnB (hcnB) from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a3360)

MetaCyc: 79% identical to hydrogen cyanide synthase HcnB subunit (Pseudomonas protegens CHA0)
Glycine dehydrogenase (cyanide-forming). [EC: 1.4.99.5]

Predicted SEED Role

"Hydrogen cyanide synthase HcnB / Opine oxidase subunit A"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YUP1 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Pf6N2E2_507 Hydrogen cyanide synthase HcnB / Opine oxidase subunit A (Pseudomonas fluorescens FW300-N2E2)
MNLDPVIVGGGPAGMAAAIELASHGVRCTLLEEAPRLGGVVYRGPLRDGVRLDYLGPRYS
EALEKLHGEFQQHAGLIDVRLSSRVMGAEGFRALVLLDADERLGEVAYSHLVLAAGCHER
SVPFPGWTLPGVMMLGGLQLQIKSGVVKPPSPVVIAGTGPLLPLVACQLHASGVAVAGVY
EACAFGRIAKESLALLNKPQLFLDGLSMLAYLKLNRIPVRYGWGVVQADGEGALSVVTVA
PYSTSWEPDLKRAEQVPAQTLAVGYGFIPRTQLSQQMGLEHGFSDDGYLRAVSDAWQQSS
EAHIHLAGDMGGIRGGEAAMLSGRIAALSILMQRNVLDPSTALARRERYQAQLERIIRFR
AAVDRYTQRGAGQTALPAADTVICRCEHTTRADIDRALEQGVQDMASLKMRTRVSMGDCQ
GRMCVGYCSDRLREATGRADVGWLRPRFPIDPIPFSAFQNLGTEAVSHD