Protein Info for Pf6N2E2_5066 in Pseudomonas fluorescens FW300-N2E2

Annotation: DJ-1/YajL/PfpI superfamily, includes chaperone protein YajL (former ThiJ), parkinsonism-associated protein DJ-1, peptidases PfpI, Hsp31

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF01965: DJ-1_PfpI" amino acids 9 to 172 (164 residues), 144 bits, see alignment E=1.9e-46 TIGR01383: DJ-1 family protein" amino acids 10 to 183 (174 residues), 165.3 bits, see alignment E=5.9e-53

Best Hits

Swiss-Prot: 36% identical to DJ1B_DROME: Protein dj-1beta (dj-1beta) from Drosophila melanogaster

KEGG orthology group: K03152, 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis (inferred from 95% identity to pba:PSEBR_a4903)

MetaCyc: 35% identical to protein/nucleic acid deglycase 3 (Escherichia coli K-12 substr. MG1655)
4.2.1.-; RXN-17632 [EC: 3.5.1.124]

Predicted SEED Role

"DJ-1/YajL/PfpI superfamily, includes chaperone protein YajL (former ThiJ), parkinsonism-associated protein DJ-1, peptidases PfpI, Hsp31"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.124

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A505 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Pf6N2E2_5066 DJ-1/YajL/PfpI superfamily, includes chaperone protein YajL (former ThiJ), parkinsonism-associated protein DJ-1, peptidases PfpI, Hsp31 (Pseudomonas fluorescens FW300-N2E2)
MMPGTKLPRALITVAEGVDDLQTVTLIDVLRRAQIEVVVASIEGRRMLTCARGTRLTADG
MLVDMLVQDFDLIVLPGGIIGAQHLANHQPLQQLVKDQAATGRFFAAIAEAPALALQAFG
VLRQRRMTCLPAVSQQLSGCSFVDQPVVVDGNCITAQGSAAALAFALTLVEQLCGKGVRN
VVAAELLA