Protein Info for Pf6N2E2_5064 in Pseudomonas fluorescens FW300-N2E2

Annotation: Xanthine/uracil/thiamine/ascorbate permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 48 to 74 (27 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 316 to 333 (18 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 374 to 400 (27 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 17 to 391 (375 residues), 199.9 bits, see alignment E=2.9e-63

Best Hits

Swiss-Prot: 51% identical to ADEP_ECOLI: Adenine permease AdeP (adeP) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 98% identity to pba:PSEBR_a4905)

MetaCyc: 51% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A147 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Pf6N2E2_5064 Xanthine/uracil/thiamine/ascorbate permease family protein (Pseudomonas fluorescens FW300-N2E2)
MLERLFQLKAHNTNVRTEILAGVTTFLAMAYILFVNPSILGETGMDKGAVFVATCLAAAI
GSTVMGLIANYPIALAPGMGLNAFFTYTVVLHMGHTWQVALGAVFISAVLFFLLSIFRIR
EWIINSIPLPLRSAIAAGIGLFLALIALNNAGIVVKNPATMVGLGDLKQPAPILATLGFV
LIVGLEALKVRGAVLIGILAVTIVSILMGFTPFGGVISMPPSLAPTFLQLDIKGALDIGL
VSVIFAFLFVDLFDNSGTLIGVAKRAGLMGKDGHMPKMGRALIADSTAAMAGSLLGTSTT
TSYIESAAGVSAGGRTGLTAVIVAILFLLALFFSPLAASVPAFATAPALLFVAVLMTSGL
AEIDWDDITVAAPVVITALAMPFTYSIANGIAFGFIAWTAIKLVSGRGRELNPALVILSI
LFVIKLGWFNA