Protein Info for Pf6N2E2_5056 in Pseudomonas fluorescens FW300-N2E2

Annotation: Hexuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 35 to 52 (18 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 103 to 130 (28 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 384 to 407 (24 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details PF07690: MFS_1" amino acids 41 to 398 (358 residues), 182.3 bits, see alignment E=6.5e-58

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 96% identity to pba:PSEBR_a4911)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A323 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Pf6N2E2_5056 Hexuronate transporter (Pseudomonas fluorescens FW300-N2E2)
MIPSQSSRLATGLSASTGGVGDKIRGAMTVGKTRWGMLALVFFATTLNYIDRAALGVMQP
ILAKEMSWTAMDYANINFWFQVGYAVGFVLQGRLIDRIGVKRVFFCAVLLWSLATGAHGL
ATSAVGFMVCRFILGLTEAANYPACVKTTRLWFPAGERAVATGIFNAGTNVGAMFTPMLL
PLVLHVWGWQAAFLCMAALGGIWLVFWGLKYFNPEDHPTVKQSELDYIQAQDEPDQVRVP
FSRILRMRGTWAFALAYSITAPVFWFYLYWLPPFLNQQYNLGINVTQMGIPLIIIYLTAD
FGSVGGGILSSFLIGRGLDPIKARLVSMLLFACCIIGVIMAAGASNLWMAVFAISLAIGA
HQAWTANIWSLVMDYTPKHMMSTVFGFGGMCAAIGGMFMTQLVGHILTVTNNNYTVLFTL
IPAMYFTALIWLYFMAPRKVPTLEN