Protein Info for Pf6N2E2_5052 in Pseudomonas fluorescens FW300-N2E2

Annotation: Hydrolase in polyol utilization gene cluster, haloacid dehalogenase-like family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 8 to 170 (163 residues), 31 bits, see alignment E=2.7e-11 PF00702: Hydrolase" amino acids 10 to 164 (155 residues), 68.3 bits, see alignment E=2.4e-22 PF12710: HAD" amino acids 10 to 160 (151 residues), 33.2 bits, see alignment E=1.4e-11 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 10 to 164 (155 residues), 34.2 bits, see alignment E=3.1e-12 PF13419: HAD_2" amino acids 67 to 170 (104 residues), 65 bits, see alignment E=2e-21 PF13242: Hydrolase_like" amino acids 127 to 170 (44 residues), 35.6 bits, see alignment 1.4e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4916)

Predicted SEED Role

"Hydrolase in polyol utilization gene cluster, haloacid dehalogenase-like family" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A152 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Pf6N2E2_5052 Hydrolase in polyol utilization gene cluster, haloacid dehalogenase-like family (Pseudomonas fluorescens FW300-N2E2)
MSLAEVRHWVFDMDGTLTIAVHDFAAIRVALAIPAEDDILTHLAALPADEAAAKHAWLLE
HERDLALGSRPAPGAVELVRELAGRGYRLGILTRNARELAHVTLEAIGLADCFAVEDVLG
RDEAPPKPHPGGLLKLAEAWSVAPEAMVMVGDYRFDLDCGRAAGARTVLVNLPDNPWPEL
TDWHARDCGELRRMLLA